PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G087600.2.p
Common NameSb03g007360, SORBIDRAFT_03g007360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 362aa    MW: 38896.1 Da    PI: 5.9381
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G087600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-173077148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT eEd ll ++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Sobic.003G087600.2.p 30 RGPWTLEEDNLLMNYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYL 77
                          89********************************************97 PP

2Myb_DNA-binding53.65.3e-1783126146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+ T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Sobic.003G087600.2.p  83 RGNLTPEEQLLILELHSKWGNR-WSRIAQHLP-GRTDNEIKNYWRT 126
                           7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8852577IPR017930Myb domain
SuperFamilySSF466896.74E-3127124IPR009057Homeodomain-like
SMARTSM007171.2E-132979IPR001005SANT/Myb domain
PfamPF002496.2E-153077IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-233184IPR009057Homeodomain-like
CDDcd001671.60E-113277No hitNo description
PROSITE profilePS5129426.09978132IPR017930Myb domain
SMARTSM007171.5E-1582130IPR001005SANT/Myb domain
PfamPF002497.1E-1683126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2485132IPR009057Homeodomain-like
CDDcd001674.24E-1387126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MSQRKGASMA AAVTSSKHHE DQEMMMELRR GPWTLEEDNL LMNYIACHGE GRWNLLARCS  60
GLKRTGKSCR LRWLNYLKPD IKRGNLTPEE QLLILELHSK WGNRWSRIAQ HLPGRTDNEI  120
KNYWRTRVQK QMAATSTAHD LHGELLPPAP PLHPSHVVAG MASSSSPIHG SHDHEQDPTS  180
NAPAGSGYYH QRYPVDPSPS TSTTSGSTSA AALPPVPCFS ELSWVDQYGY GPYSYTTDLD  240
GAAGVSSFDD DSAALESLGL DGLDLGPAEA DSDVLYSDTT LLDYLNSTCA GGGTMMTMMG  300
GGVGGGSVVH NSCGGAMGGC GDDVAEYGRP TSSSSWRTDE LVFQASARKL GDHQHQWGGG  360
I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-27271321105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794270.0HF679427.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB21 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455261.10.0hypothetical protein SORBIDRAFT_03g007360
TrEMBLC5XQX00.0C5XQX0_SORBI; Putative uncharacterized protein Sb03g007360
STRINGSb03g007360.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.18e-65myb domain protein 62